CSF1 antibody

Tested for WB

Cross Reactivity Human

Raised in Rabbit

Concentration 1 mg/ml

Shipping conditions Blue Ice

French translation anticorps

Area of research Immunology

Usage Recommendations WB: 1 ug/ml

Category Primary Antibody

Method of Purification Affinity purified

Antibody Subtype Polyclonal Antibodies, Purified

Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSF1 antibody in PBS

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Type of Immunogen CSF1 antibodies were raised using a synthetic peptide corresponding to a region with amino acids MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP

Assay Information CSF1 Blocking Peptide, catalog no. 33R-5719, is also available for use as a blocking control in assays to test for specificity of this CSF1 antibody

Additional Information This is a rabbit polyclonal antibody against CSF1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com