CSF1 Blocking Peptide

Tested for WB; IHC

Shipping conditions Blue Ice

Category Proteins

Type of protein Synthetic

Area of research Immunology

Properties blocking peptide

Antibody Subtype Blocking Peptides

Residues PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

Test You can block the antibody by the specific target amino acid sequence of peptide.

Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.