210 EUR
33R-7283
100 µg
Tested for WB; IHC
Shipping conditions Blue Ice
Category Proteins
Type of protein Synthetic
Area of research Immunology
Properties blocking peptide
Antibody Subtype Blocking Peptides
Residues PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Test You can block the antibody by the specific target amino acid sequence of peptide.
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.