Rabbit CSF1 antibody

Clone NA

Specificity NA

Applications WB

Cross Reactivity Human

Concentration 1 mg/ml

Shipping Info Blue Ice

French translation anticorps

Research Area Immunology

Product Type Primary Antibodies

Latin name Oryctolagus cuniculus

Product Subtype Purified Polyclonal Antibodies

Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSF1 antibody in PBS

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Immunogen CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP

About Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.