495 EUR
70R-6442
50 ug
Clone NA
Specificity NA
Applications WB
Cross Reactivity Human
Concentration 1 mg/ml
Shipping Info Blue Ice
French translation anticorps
Research Area Immunology
Product Type Primary Antibodies
Latin name Oryctolagus cuniculus
Product Subtype Purified Polyclonal Antibodies
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSF1 antibody in PBS
Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Immunogen CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP
About Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.