497 EUR
CB34-50
50 ug
Species reactivity Mouse
UniProt number P07141
Estimated molecular weight 26 kDa
Origin Human cells
Group recombinants
Latin name Mus musculus
Shipping condition Ambient/Room Temperature
Source Recombinants or rec. proteins
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Package form Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Description Recombinant Mouse Macrophage colony-stimulating factor 1 is produced by our Mammalian expression system and the target gene encoding Lys33-Glu262 is expressed.
Peptide sequence KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLEVDHHHHHH
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Test Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.