497 EUR
CB53-50
50 ug
Species reactivity Mouse
UniProt number P09920
Estimated molecular weight 19,8 kDa
Origin Human cells
Tissue granulocyte
Group recombinants
Latin name Mus musculus
Shipping condition Ambient/Room Temperature
Source Recombinants or rec. proteins
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Package form Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Peptide sequence VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLAHHHHHH
Description Recombinant Mouse Granulocyte Colony-Stimulating Factor is produced by our Mammalian expression system and the target gene encoding Val31-Ala208 is expressed with a 6His tag at the C-terminus.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Test Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Gene Granulocyte-colony stimulating factor (G-CSF or GCSF), also known as colony-stimulating factor 3 (CSF 3), is a glycoprotein that stimulates the bone marrow to produce granulocytes and stem cells and release them into the bloodstream. Functionally, it is a cytokine and hormone, a type of colony-stimulating factor, and is produced by a number of different tissues. The pharmaceutical analogs of naturally occurring G-CSF are called filgrastim and lenograstim.
Additional description Colonies can be formed by stimulating factors or recombinant GM-CSF and CSFs activity expressed in Units compared to a standard.Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.