CSF1 Blocking Peptide

Our Suppliers

Price

280 EUR

Catalog no.

33R-7283

Size

100 ug

Applications WB, IHC
Shipping Info Blue Ice
Product Type Proteins
Type1 Synthetic
Research Area Immunology
Properties blocking peptide
Product Subtype Blocking Peptides
Tag/Conjugate PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Test You can block the antibody by the specific target amino acid sequence of peptide.
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.